PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00305.1_g00025.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 292aa    MW: 32955.4 Da    PI: 6.5279
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00305.1_g00025.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.49.7e-5261301128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeelv++yL++k++++++ +  +i+e+d+yk++Pw+Lp  +  +ekewyfFs+rd+ky++g+r+nr++ sgyWkat
  Rsa1.0_00305.1_g00025.1   6 LPPGFRFHPTDEELVMHYLCRKCASQSIAV-PIIAEIDLYKYDPWELPGLALYGEKEWYFFSPRDRKYPNGSRPNRSAGSGYWKAT 90 
                              79*************************999.88***************6555679******************************* PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g dk++     + vg+kk Lvfy g+ap+gekt+W+mheyrl
  Rsa1.0_00305.1_g00025.1  91 GADKPIGL--PKPVGIKKALVFYAGKAPRGEKTNWIMHEYRL 130
                              ******99..789***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.59E-623158IPR003441NAC domain
PROSITE profilePS5100560.2336158IPR003441NAC domain
PfamPF023651.6E-277130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MSEMQLPPGF RFHPTDEELV MHYLCRKCAS QSIAVPIIAE IDLYKYDPWE LPGLALYGEK  60
EWYFFSPRDR KYPNGSRPNR SAGSGYWKAT GADKPIGLPK PVGIKKALVF YAGKAPRGEK  120
TNWIMHEYRL ADVDRSAARK KKNSLRLDDW VLCRIYNKKG AIEKRGPPPP PTPVGYGGIS  180
DEAVEEKPRL SEMGMPPPPV MANDFVYFDT SDSVPKLHTT ESSCSEQVVS PEFTSEVQSE  240
PKWKDWSGDK SSLDYGFNYI DATVDNAFGG EGGSNQLFPL QDMFMYNMPK PF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-82216411174Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00121DAPTransfer from AT1G01720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2458850.0AY245885.1 Brassica napus NAC-domain protein 18 (NAC18) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009119728.10.0PREDICTED: NAC domain-containing protein 2
SwissprotQ390130.0NAC2_ARATH; NAC domain-containing protein 2
TrEMBLM4EWQ40.0M4EWQ4_BRARP; Uncharacterized protein
TrEMBLQ7Y1A60.0Q7Y1A6_BRANA; BnaA10g00280D protein
STRINGBra033239.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-180NAC family protein